Deviation Actions

wyldraven's avatar

Exile

By wyldraven
89 Favourites
19 Comments
1K Views
castledarkcastlefantasycastlewyldraven
Nearly 2021 and I've been procrastinating with artworks in recent months. My laptop flatlined in November which didn't help matters. But I did manage to finish the Black Metal tarot which took 9 long years to complete. I'll be uploading some new pictures from that and hope to get it into publication next year.

I call this one Exile for things I learned earlier this year.  I don't even know where to begin but to make it short, I'd always had a lot of profound fantasies and visions which I found out were my past life memories. I learned I had been sent into exile in an ancient past and a castle was the place where I was held.  Castles often turn up in my artworks. They represent to me a place of captivity, isolation but also sanctuary.

Stock came from various public domain images.
Image details
Image size
2388x1618px 2.98 MB
Published:
© 2020 - 2021 wyldraven
Comments19
anonymous's avatar
Join the community to add your comment. Already a deviant? Log In
baroquedoll's avatar
baroquedoll

The home of my dreams....!!! You can't imagine the joy of seeing it !! :rose: :pumpkin:

wyldraven's avatar
wyldraven

thank you! :heart: Nice to meet another castle-lover :)

baroquedoll's avatar
baroquedoll

Always been fascinated by castles already as a kid!! :rose:

wyldraven's avatar
wyldraven

thank you :)

Yuukon's avatar
Yuukon

This piece conveys a lot of mystery. I really like the atmosphere you’ve put down with this work, the darkness, the mystery, it all makes me very curious as to what is going on in that castle on the hill, especially that one light light coming from the window up in the tower makes me curious. I really like the amount of detail you have put in this piece in overall, there are a lot of small things to be reckoned with, and the piece wouldn’t be the same without any of them. They all add to the mystery. I think you did a wonderful job, keep it up!


This critique brought to you by We Three Pirate Kings, Merry Critmas!

wyldraven's avatar
wyldraven

thank you for the critique! I think this is my first :)

I am glad that it invokes a sense of mystery... I wasn't sure if the artwork was good as it hasn't done as well as my previous ones.

DaveMikulec's avatar
DaveMikulec

Good to see your return. And your remarks are even more interesting and will certainly impact how I view your art. Nicely done.

wyldraven's avatar
wyldraven

thanks! :) I'd always thought my artworks were reflections of a past life. I am sure this is true for other artists too.

kleinerteddy's avatar
kleinerteddy

That is very nice.

SueMArt's avatar
SueMArt

Great work.

SueMArt's avatar
SueMArt

My pleasure. :heart:

wyldraven's avatar
wyldraven

thank you :)

Deadpoolbutt's avatar
Deadpoolbutt

I can't find proper words to say how fantastic this is. Been awhile since you published, everything alright?

wyldraven's avatar
wyldraven

thank you!! yes, everything is fine :) I was busy this year finishing my tarot and I think I just needed a break from art for a while.

Deadpoolbutt's avatar
Deadpoolbutt

Ah, ok! Glad to know :D

anonymous's avatar
Join the community to add your comment. Already a deviant? Log In