Deviation Actions
![Bloated Nessa [Alt]](https://images-wixmp-ed30a86b8c4ca887773594c2.wixmp.com/f/54cfbeba-9667-47d6-9e56-83b4748acc06/de5hlsn-14859556-dab8-4d19-b0c3-7669261aee95.png/v1/fit/w_150,h_150,q_70,strp/bloated_nessa__alt__by_metalforever_de5hlsn-150.jpg?token=eyJ0eXAiOiJKV1QiLCJhbGciOiJIUzI1NiJ9.eyJzdWIiOiJ1cm46YXBwOiIsImlzcyI6InVybjphcHA6Iiwib2JqIjpbW3siaGVpZ2h0IjoiPD0zMjAwIiwicGF0aCI6IlwvZlwvNTRjZmJlYmEtOTY2Ny00N2Q2LTllNTYtODNiNDc0OGFjYzA2XC9kZTVobHNuLTE0ODU5NTU2LWRhYjgtNGQxOS1iMGMzLTc2NjkyNjFhZWU5NS5wbmciLCJ3aWR0aCI6Ijw9MjYwMCJ9XV0sImF1ZCI6WyJ1cm46c2VydmljZTppbWFnZS5vcGVyYXRpb25zIl19.0NT50hO2f_zSWxszRxB0nwzFR_CQB1p91knZ_1V_CF0)
Featured in collections
You Might Like . . .
![Conquering the Meat Mountain [Patreon Teaser]](https://images-wixmp-ed30a86b8c4ca887773594c2.wixmp.com/f/2e8419ec-66e1-413e-84e5-2c626fe9b81b/debhav2-166b609a-2fb1-4f95-9e58-bc07f82b9532.png/v1/fit/w_150,h_150,q_70,strp/conquering_the_meat_mountain__patreon_teaser__by_better_with_salt_debhav2-150.jpg?token=eyJ0eXAiOiJKV1QiLCJhbGciOiJIUzI1NiJ9.eyJzdWIiOiJ1cm46YXBwOiIsImlzcyI6InVybjphcHA6Iiwib2JqIjpbW3siaGVpZ2h0IjoiPD00OTIiLCJwYXRoIjoiXC9mXC8yZTg0MTllYy02NmUxLTQxM2UtODRlNS0yYzYyNmZlOWI4MWJcL2RlYmhhdjItMTY2YjYwOWEtMmZiMS00Zjk1LTllNTgtYmMwN2Y4MmI5NTMyLnBuZyIsIndpZHRoIjoiPD03NDYifV1dLCJhdWQiOlsidXJuOnNlcnZpY2U6aW1hZ2Uub3BlcmF0aW9ucyJdfQ.Xh3NqM42nSpFrY44SdCm6uL5_f4QssvdnAjhMHBkIXs)
January 2021 Patreon Preview
By Metalforever
358 Favourites15 Comments57K Views
bellyblakechampioncynthiafemalepreviewstuffingvoreweightyangpatreonrwbynicorobinweightgainexpansioninflationserleenafemaleweightgaincynthiapokemonnicorobinonepiecestuffedbellykurisumakiseblakebelladonnayangxiaolongryukomatoiryukomatoikilllakillsequenceexpansionstuffingandweightgainpatreon_rewardfemalebellyexpansionpogchampmeme
Each month the top 3 poll winners are drawn as color sketch sequences with 4th and 5th place being drawn as color sketches. In addition there are up to 10 black and white patron sketches for top tier Patrons.
Gain early access to my art,
The ability to vote in polls,
The ability to suggest a character,
exclusive Photoshop files, works in progress and more at my Patreon:
www.patreon.com/MetalForeverAr…
December's Color Sketch Sequences:
#1 Cynthia from Pokemon (6 part Vore into Weight Gain sequence with a bonus animated version of the sequence! Plus an alternative non-vore /Stuffing animation and and a non-vore/Stuffing sequence versions)
#2 Yang Xiao Long (4 part Stuffing sequence; A direct sequel to Blakes, featuring a bloated Blake along side Yang with alternative Vore and outie belly button / Preggo versions)
#3 Nico Robin (3 part Weight gain into Vore sequence with alternative an Stuffing version. Plus Pregnancy / outie belly button + alt dialog for both tummy types)
December's Color Sketches:
#4 Serleena (Massive butterball BBW along with implied vore: Alternative versions include a Stuffing / non vore alternative version with alt dialog, plus Sweaty versions for both tummy types)
#5 Ryuko Matoi (Chubby Weight Gain with Pregnancy alt version and Pogchamp meme versions for both tummy types, with different dialog)
Bonus Images:
a. A super fat blob Kurisu and bbw Suzuha
b. 10 black and white sketches for top tier patrons
c. 3 rough black and white runner up sketches of girls who did not win this month's poll
Gain early access to my art,
The ability to vote in polls,
The ability to suggest a character,
exclusive Photoshop files, works in progress and more at my Patreon:
www.patreon.com/MetalForeverAr…
December's Color Sketch Sequences:
#1 Cynthia from Pokemon (6 part Vore into Weight Gain sequence with a bonus animated version of the sequence! Plus an alternative non-vore /Stuffing animation and and a non-vore/Stuffing sequence versions)
#2 Yang Xiao Long (4 part Stuffing sequence; A direct sequel to Blakes, featuring a bloated Blake along side Yang with alternative Vore and outie belly button / Preggo versions)
#3 Nico Robin (3 part Weight gain into Vore sequence with alternative an Stuffing version. Plus Pregnancy / outie belly button + alt dialog for both tummy types)
December's Color Sketches:
#4 Serleena (Massive butterball BBW along with implied vore: Alternative versions include a Stuffing / non vore alternative version with alt dialog, plus Sweaty versions for both tummy types)
#5 Ryuko Matoi (Chubby Weight Gain with Pregnancy alt version and Pogchamp meme versions for both tummy types, with different dialog)
Bonus Images:
a. A super fat blob Kurisu and bbw Suzuha
b. 10 black and white sketches for top tier patrons
c. 3 rough black and white runner up sketches of girls who did not win this month's poll
Image details
Image size
3000x1200px 1.88 MB
Published: Â Â |Â Â Mature
© 2021 Metalforever
Comments15
Join the community to add your comment. Already a deviant? Log In
When are you posting the Pokemon stuff?
Later this month
Here be me barrel rolling past anime girls and laser focussing on that one girl who we've seen a thousand times already. AND I'D DO IT A THOUSAND TIMES AGAIN.
I'm excited for hilda
I can't wait for Nico Robin and Serleena. Are you going to do a continuation with the Nami Sequence as well as doing a Boa Hancock one?
The pokemon one for sure
WOOOOOOOOOOO YEAH BABY THATS WHAT IVE BEEN WAITING FOR
I am mostly excited for cythina and Hilda one along with Serleena. Others as well.
Thank you for finally blessing us with my waifu
There are so little works of robin so I’m excited
I see RWBY I become interested
Sarleena as butterball?
Good
>Sarleena
YES!!!!!!!!!!!!
Its always good news to see chubby and pregnant Ryuko art ^¬^
Ooooooo these look like they gonna be amazing like always 😊
Join the community to add your comment. Already a deviant? Log In