ShopDreamUp AI ArtDreamUp
Deviation Actions
Buy Premium Download
210 Favourites
4 Sold
1 attached file
Starry Galaxy Night.jpg
17.46 MB - 5000 x 3333
Promoted Deviations
Suggested Deviants
Suggested Collections
Featured in Groups
abstractartisticastronomicalbackgroundbeautifulbeautybigbangbrilliantbrownbrushcelestialcirclescolorfulconceptconceptualconstellationcontrastcosmiccosmologycosmoscreativecurvingcurvydigitaldivinedreamyepicfantasticfantasygalaxygeometricgeometricalglowglowinggoldgoldenhighlightsilluminationillustrationmanipulatedmixedmoonnebulanebulasnicolasnightorangepaintpaintingphotomanipulatedraymondroundsciencefictionspiralstarstarrystrokesswirlingtextureuniversevividwhirlpoolsomadjinnart
Description
Mixed media photomanipulation combining a space image of the Whirlpool Galaxy (M51) and a classic public domain painting called The Starry Night by Vincent van Gogh (circa 1889).
Space image courtesy of ESA/Hubble, more specifically:
NASA, ESA, S. Beckwith (STScI), and The Hubble Heritage Team STScI/AURA)
NASA, ESA, S. Beckwith (STScI), and The Hubble Heritage Team STScI/AURA)
Offered under a Creative Commons license / Attribution Unported. Meaning Yes for commercial use including premade backgrounds as long as you credit and link back to me. More details on my stock rules here: somadjinn.deviantart.com/journ…
Now included for download on my Patreon account if you want access to an ever-growing collection of my high res stock for one monthly subscription fee.
You can find this specific image at the following post: www.patreon.com/posts/starry-g…
Image size
5000x3333px 17.46 MB
Comments45
Join the community to add your comment. Already a deviant? Log In
Thanks,used here:Which weights more?